PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family G2-like
Protein Properties Length: 408aa    MW: 45782.1 Da    PI: 6.8544
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04145.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.56.2e-33257312156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  PK04145.1 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 312
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.115254314IPR017930Myb domain
SuperFamilySSF466893.58E-18254315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-29255315IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-27257312IPR006447Myb domain, plants
PfamPF002496.4E-8259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSIPSELSL DFRASYVPKS IHEFLNEVST IENVPERASK LGDFVRRLEE EMKKIDAFKR  60
ELPLCMILLS DAILTLKKES SQCAVTTNPQ PVLEEFIPMK KDCEEEDEER EEHKKNKNEK  120
DSRDKKNWMS SVQLWNTDDI SSGDHLNKNS KQNSMTQTKM NDEKILKNED PFPSCRNRSS  180
ERSFAPFIKP YSGFLVRKEE KDEFSIPGLS LLTPGLKNPK EESGCGNARS NSGRAVSSSP  240
ANVHSNLRIG SQQTARKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE LMQVDGLTND  300
EVKSHLQKYR LHTRRVPSGT SAPANQSVVV LGGLWLGQDQ YGDSSKASSS QSGSPQGPLQ  360
LAATRGGSPT TGDEDSMQDD DDDDDAKSEG FSWKNHLHKP LKDDVHRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107986.10.0Two-component response regulator
TrEMBLW9S9080.0W9S908_9R
STRINGVIT_03s0063g01060.t011e-162(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-55G2-like family protein